Description
Anthopleurin-A is a disulfide-bonded cyclic peptide with a sequence of 49 amino acids. It can be isolated from sea anemones and is known for its remarkable biological activity. This molecule has been demonstrated to inhibit the uptake of sodium ions (Na+) in cardiac tissue by binding to sodium channels. As a result, it leads to an increase in intracellular Na+ concentrations, which triggers a cascade of biochemical reactions that culminate in cell depolarization and enhanced contraction of heart muscle. Additionally, Anthopleurin-A exhibits stem cell factor-like activity in experimental models, likely owing to its capacity to stimulate the proliferation of stem cells. These properties not only highlight its potential therapeutic applications in cardiac function but also suggest a role in regenerative medicine through stem cell modulation.
Specification
| Item | Anthopleurin-A |
|---|
| Catalog | MC60880639 |
| CAS | 60880-63-9 |
| Molecular Formula | C220H326N64O67S6 |
| Molecular Weight | 5131.72 |
| Purity | 99% |
| Sequence | Gly-Val-Ser-Cys-Leu-Cys-Asp-Ser-Asp-Gly-Pro-Ser-Val-Arg-Gly-Asn-Thr-Leu-Ser-Gly-Thr-Leu-Trp-Leu-Tyr-Pro-Ser-Gly-Cys-Pro-Ser-Gly-Trp-His-Asn-Cys-Lys-Ala-His-Gly-Pro-Thr-Ile-Gly-Trp-
Cys-Cys-Lys-Gln (Disulfide bridge: Cys4-Cys46, Cys6-Cys36, Cys29-Cys47) |
| Sequence Shortening | GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ (Disulfide bridge:
Cys4-Cys46, Cys6-Cys36, Cys29-Cys47) |
| MDL | MFCD00240628 |
| InChI Key | DCHLNFQWPLNLQG-OWIWTKNASA-N |
| Smiles | CCC(C)C(C(=O)NCC(=O)NC(CC1=CC=C(C=C1)O)C(=O)NC(CS)C(=O)NC(CS)C(=O)NC(CCCCN)
C(=O)NCC(=O)O)NC(=O)C(C(C)O)NC(=O)C2CCCN2C(=O)CNC(=O)C(CC3=CN=CN3)NC(=O)C(C)
NC(=O)C(CCCCN)NC(=O)C(CS)NC(=O)C(CC(=O)N)NC(=O)C(CC4=CN=CN4)NC(=O)C
(CC5=CNC6=CC=CC=C65)NC(=O)CNC(=O)C(CO)NC(=O)C7CCCN7C(=O)C(CS)NC(=O)CNC(=O)
C(CO)NC(=O)C8CCCN8C(=O)C(CC9=CC=C(C=C9)O)NC(=O)C(CC(C)C)NC(=O)C
(CC1=CNC2=CC=CC=C21)NC(=O)C(CC(C)C)NC(=O)C(C(C)O)NC(=O)CNC(=O)C(CO)NC(=O)C
(CC(C)C)NC(=O)C(C(C)O)NC(=O)C(CC(=O)N)NC(=O)CNC(=O)C(CCCNC(=N)N)NC
(=O)C(C(C)C)NC(=O)C(CO)NC(=O)C1CCCN1C(=O)CNC(=O)C(CC(=O)O)
NC(=O)C(CO)NC(=O)C(CC(=O)O)NC(=O)C(CS)NC(=O)C(CC(C)C)
NC(=O)C(CS)NC(=O)C(CO)NC(=O)C(C(C)C)NC(=O)CN |
| Storage | Keep dry and keep away from sunlight at -20 °C |
Therapeutic Implications
Due to its unique properties, anthopleurin-A has potential therapeutic uses, especially in treating heart failure. Anthopleurin-A influences cardiac function by binding to sodium channels, specifically affecting cardiac myocytes. It slow the inactivation of these sodium channels, resulting in enhanced contractility of cardiac muscle without significantly altering heart rate. It is more potent than existing cardiac glycosides with fewer side effects. However, its stability and potential immunological reactions in humans present challenges for direct therapeutic applications.
Choose Alfa Chemistry
With a strong commitment to quality and a relentless pursuit of innovation, Alfa Chemistry strives to unleash the unlimited potential of marine resources and provide a diverse range of quality products. We have the ability to provide you with high-quality anthopleurin-A at a competitive price. If you have any requirements, please contact us immediately.
For Research Use Only. Not for use in diagnostic or therapeutic procedures.
