Description
Anthopleurin-C is a bioactive peptide derived from the sea anemone species Anthopleura elegantissima, has attracted attention in biomedical research for its potential therapeutic applications. It is a powerful cardiotoxin that exerts significant effects on mammalian heart muscle, inducing both positive inotropic and chronotropic responses. This compound not only enhances the strength of cardiac muscle contractions but also accelerates the heart rate. Additionally, Anthopleurin-C alters the behavior of fast sodium (Na+) channels in neuroblastoma cells, resulting in delayed and incomplete inactivation of these channels. This modification can have important implications for cellular excitability and overall cardiac function, highlighting the dual role of Anthopleurin-C as both a cardiotonic agent and a modulator of ion channel dynamics. Its unique origin and biological activities not only highlight the intricate relationships within marine ecosystems but also open avenues for the development of novel pharmaceuticals derived from marine biodiversity.
Specification
| Item | Anthopleurin-C |
|---|
| Catalog | MC041 |
| Origin | Anthopleura elegantissima (Green aggregating anemone) (Actinia elegantissima) |
| Molecular Formula | C210H316N62O61S6 |
| Molecular Weight | 4878 Da |
| Form | Lyophilized Powder |
| Purity | >98% |
| Sequence | Gly-Val-Pro-Cys-Leu-Cys-Asp-Ser-Asp-Gly-Pro-Ser-Val-Arg-Gly-Asn-Thr-Leu-Ser-Gly-Ile-Leu-Trp-Leu-Ala-Gly-Cys-Pro-Ser-Gly-Trp-His-Asn-Cys-Lys-Ala-His-Gly-Pro-Thr-Ile-Gly-Trp-Cys-Cys-Lys-Gln (Disulfide bridge: Cys4-Cys44, Cys6-Cys34, Cys27-Cys45) |
| Sequence Shortening | GVPCLCDSDGPSVRGNTLSGILWLAGCPSGWHNCKAHGPTIGWCCKQ (Disulfide bridge: Cys4-Cys44, Cys6-Cys34, Cys27-Cys45) |
| Peptide Content | 100% |
| Storage | Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20 °C. Protect from light and moisture. |
| Solubility | Soluble in DDW (deuterium depleted water) |
| Storage of Solutions | Store up to one week at 4 °C or up to 6 months at -20 °C |
Choose Alfa Chemistry
With a strong commitment to quality and a relentless pursuit of innovation, Alfa Chemistry strives to unleash the unlimited potential of marine resources and provide a diverse range of quality products. We have the ability to provide you with high-quality anthopleurin-C at a competitive price. If you have any requirements, please contact us immediately.
For Research Use Only. Not for use in diagnostic or therapeutic procedures.
